PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0517s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 394aa    MW: 44121.8 Da    PI: 8.8
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0517s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.4e-3347101155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kprl+Wtp+LHerF+eav+qLGG++kAtPk++++lm++ gLtl+h+kSHLQkYRl
  Kalax.0517s0012.1.p  47 KPRLKWTPDLHERFIEAVHQLGGPDKATPKSVMKLMGISGLTLYHLKSHLQKYRL 101
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.98544104IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-3145102IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1646102IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-2447102IPR006447Myb domain, plants
PfamPF002495.9E-1149100IPR001005SANT/Myb domain
PfamPF143791.9E-24146192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MYHHHQNHGK NFHSSSRNPI PPERHLFLQP GANGPGDSGL VLSTDAKPRL KWTPDLHERF  60
IEAVHQLGGP DKATPKSVMK LMGISGLTLY HLKSHLQKYR LSKNLHGQPN GSTNKLVTAA  120
AGQKIPEATE TTVSSPSTGS QSNKLQISET LQMQIEVQRR LHEQLEVQRH LQLRIEAQGK  180
YLQSVLEKAQ ETLGRQNLGT VGLEAAKAQI NDLVSKVSTQ CLNSPFSVNK GELHALCTQH  240
LQMTQQANGS LDNCLTNGSH NRHSVGFEMM QCKQNWHNDH RMILPSFAGD TERQVLLMED  300
SPSGLSMGIG LHQEKRDKRS TYPEPKIRKQ DDADELLFKR PSNKNQSLNM ENERLSLGCR  360
MPSMEPKLDL NSHEEHDASR GCKQFDLNGF SWN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325408.21e-157myb family transcription factor family protein
TrEMBLB9IPM91e-157B9IPM9_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0019s04820.11e-157(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-120G2-like family protein